• Login
  • Register
Login
Username:
Password: Lost Password?
 
EpicLeaks
  • Home
  • Search
  • Member List
  • Help
  • Report Content
    • Login
    • Register
    Login
    Username:
    Password: Lost Password?
     
Girl in a jacket

EpicLeaks › Amateur Porn › Voyeur and Spycams › Real Voyeur and Hidden Videos

Pages (2237): « Previous 1 … 1427 1428 1429 1430 1431 … 2237 Next »
Jump to page 
Thread Rating:
  • 0 Vote(s) - 0 Average
  • 1
  • 2
  • 3
  • 4
  • 5
[-]
Welcome
You have to register before you can post on our site.

Username:


Password:

[-]
Top Poster
no avatar Congratulations to pornbos, our current top poster for the last day with 4 posts!

[-]
Statistics
» Members: 23,168
» Latest member: drahtlos
» Forum threads: 61,739
» Forum posts: 1,728,741

Full Statistics

[-]
Search








(Advanced Search)

Threaded Mode
Real Voyeur and Hidden Videos
MysteriousMan Offline
Posting Freak
Posts: 123,292
Threads: 248
Joined: Nov 2021
Reputation: 0
#14,281
11-22-2022, 08:48 AM
1214 Vbaafj


[Image: 301290944_1214_vbaafj.jpg]

[Image: 301290945_1214_vbaafj.jpg]

[Image: 301290946_1214_vbaafj.jpg]


[Image: 301290957_1214_vbaafj.jpg]

Click here to download:
1214_vbaafj.mp4
Click here for more Previews
Reply
MysteriousMan Offline
Posting Freak
Posts: 123,292
Threads: 248
Joined: Nov 2021
Reputation: 0
#14,282
11-22-2022, 08:58 AM
Changing Room Aeuivca


[Image: 301490523_changing_room_aeuivca.jpg]

[Image: 301490524_changing_room_aeuivca.jpg]

[Image: 301490526_changing_room_aeuivca.jpg]


[Image: 301490600_changing_room_aeuivca.jpg]

Click here to download:
Changing Room_aeuivca.avi
Click here for more Previews
Reply
MysteriousMan Offline
Posting Freak
Posts: 123,292
Threads: 248
Joined: Nov 2021
Reputation: 0
#14,283
11-22-2022, 09:07 AM
Girlfriendshowerp Vbadax


[Image: 301173639_girlfriendshowerp_vbadax.jpg]

[Image: 301173640_girlfriendshowerp_vbadax.jpg]

[Image: 301173641_girlfriendshowerp_vbadax.jpg]


[Image: 301173648_girlfriendshowerp_vbadax.jpg]

Click here to download:
girlfriendshowerp_vbadax.mp4
Click here for more Previews
Reply
MysteriousMan Offline
Posting Freak
Posts: 123,292
Threads: 248
Joined: Nov 2021
Reputation: 0
#14,284
11-22-2022, 09:17 AM
Voyeur Upskirt Creepshot Vcb Abqn


[Image: 301782636_voyeur_upskirt_creepshot_vcb_abqn.jpg]

[Image: 301782637_voyeur_upskirt_creepshot_vcb_abqn.jpg]

[Image: 301782638_voyeur_upskirt_creepshot_vcb_abqn.jpg]


[Image: 301782643_voyeur_upskirt_creepshot_vcb_abqn.jpg]

Click here to download:
voyeur_upskirt_creepshot_vcb_abqn.avi
Click here for more Previews
Reply
MysteriousMan Offline
Posting Freak
Posts: 123,292
Threads: 248
Joined: Nov 2021
Reputation: 0
#14,285
11-22-2022, 09:26 AM
Latin Girl Masturbates Watching Porn Vbagzx


[Image: 301308603_latin_girl_masturbates_watchin...vbagzx.jpg]

[Image: 301308604_latin_girl_masturbates_watchin...vbagzx.jpg]

[Image: 301308606_latin_girl_masturbates_watchin...vbagzx.jpg]


[Image: 301308619_latin_girl_masturbates_watchin...vbagzx.jpg]

Click here to download:
latin girl masturbates watching porn_vbagzx.mp4
Click here for more Previews
Reply
MysteriousMan Offline
Posting Freak
Posts: 123,292
Threads: 248
Joined: Nov 2021
Reputation: 0
#14,286
11-22-2022, 09:35 AM
Changing Room Aeyivca


[Image: 301435176_changing_room_aeyivca.jpg]

[Image: 301435177_changing_room_aeyivca.jpg]

[Image: 301435179_changing_room_aeyivca.jpg]


[Image: 301435240_changing_room_aeyivca.jpg]

Click here to download:
Changing Room_aeyivca.avi
Click here for more Previews
Reply
MysteriousMan Offline
Posting Freak
Posts: 123,292
Threads: 248
Joined: Nov 2021
Reputation: 0
#14,287
11-22-2022, 09:44 AM
Hot Blonde Sucks Gloryhole Dick In A Changing Room Vbagja


[Image: 301257779_hot_blonde_sucks_gloryhole_dic...vbagja.jpg]

[Image: 301257784_hot_blonde_sucks_gloryhole_dic...vbagja.jpg]

[Image: 301257790_hot_blonde_sucks_gloryhole_dic...vbagja.jpg]


[Image: 301257873_hot_blonde_sucks_gloryhole_dic...vbagja.jpg]

Click here to download:
Hot Blonde Sucks Gloryhole Dick In a Changing Room_vbagja.mp4
Click here for more Previews
Reply
MysteriousMan Offline
Posting Freak
Posts: 123,292
Threads: 248
Joined: Nov 2021
Reputation: 0
#14,288
11-22-2022, 09:54 AM
Voyeur Nipslip Hiddensex Vcc Aatl


[Image: 301850818_voyeur_nipslip_hiddensex_vcc_aatl.jpg]

[Image: 301850819_voyeur_nipslip_hiddensex_vcc_aatl.jpg]

[Image: 301850821_voyeur_nipslip_hiddensex_vcc_aatl.jpg]


[Image: 301850841_voyeur_nipslip_hiddensex_vcc_aatl.jpg]

Click here to download:
voyeur_nipslip_hiddensex_vcc_aatl.avi
Click here for more Previews
Reply
chat chat chat

chat

MysteriousMan Offline
Posting Freak
Posts: 123,292
Threads: 248
Joined: Nov 2021
Reputation: 0
#14,289
11-22-2022, 10:03 AM
Voyeurhiddenspycamerafemalenakedmasturbati Vbakvx


[Image: 301341854_voyeurhiddenspycamerafemalenak...vbakvx.jpg]

[Image: 301341855_voyeurhiddenspycamerafemalenak...vbakvx.jpg]

[Image: 301341856_voyeurhiddenspycamerafemalenak...vbakvx.jpg]


[Image: 301341874_voyeurhiddenspycamerafemalenak...vbakvx.jpg]

Click here to download:
Voyeurhiddenspycamerafemalenakedmasturbati_vbakvx.mp4
Click here for more Previews
Reply
MysteriousMan Offline
Posting Freak
Posts: 123,292
Threads: 248
Joined: Nov 2021
Reputation: 0
#14,290
11-22-2022, 10:12 AM
Voyeur Nipslip Hiddensex Vcc Acrm


[Image: 301851163_voyeur_nipslip_hiddensex_vcc_acrm.jpg]

[Image: 301851164_voyeur_nipslip_hiddensex_vcc_acrm.jpg]

[Image: 301851166_voyeur_nipslip_hiddensex_vcc_acrm.jpg]


[Image: 301851179_voyeur_nipslip_hiddensex_vcc_acrm.jpg]

Click here to download:
voyeur_nipslip_hiddensex_vcc_acrm.avi
Click here for more Previews
Reply
« Next Oldest | Next Newest »
Pages (2237): « Previous 1 … 1427 1428 1429 1430 1431 … 2237 Next »
Jump to page 


  • View a Printable Version
Forum Jump:


Users browsing this thread: 3 Guest(s)
[-]
Latest Posts
Top Teen Models Videos Collection
New 2025 Update - Ed Blonde Teen Onlyfans Fansly Creator Slimmaddiepattie Striptease - Teen Girls Se...pornbos — 04:18 PM
Asian Pussy Secrets Videos Collection
Asian Teens Sexy Show on Cam and Home HardCore - Japanese, Korean, China etc. Video Information: ...pornbos — 03:08 PM
hexa pneumococci 7 - купить онлайн в интернет-магазине химмед
4 methoxyphenoxyacetaldehyde diethyl acetal - купить онлайн в интернет-магазине химмед Tegs: hexa...Lavillgen — 01:40 PM
mesoxm
4 hydroxynonenal antibody 12f7 biotin - купить онлайн в интернет-магазине химмед Tegs: haemophilu...Lavillgen — 01:39 PM
проектирование внутренних инженерных систем - ayu.group
Как начальник эксплуатации, я искал подрядчика, чтобы сделать проект пожарной сигнализации на объект...Vladomete — 01:39 PM
проектирование инженерных систем дома - ayu.group
Если вам нужна уверенность в завтрашнем дне, стоит заказать проектирование систем пожарной безопасно...Leorpbezax — 10:19 AM
see this here
click for more info jaxx bitcoin walletJosephbeifs — 05:54 AM
Top Teen Models Videos Collection
New 2025 Update - Tching My Tight Teen Ass - Teen Girls Sexy Show on Cam Video Information: File...pornbos — 04:16 AM
Asian Pussy Secrets Videos Collection
Asian Teens Sexy Show on Cam and Home HardCore - Japanese, Korean, China etc. Video Information: ...pornbos — 03:07 AM
check that
top article breadwalletHoraceTew — 02:49 AM
mesoxm
audiobookkeeper.ru cottagenet.ru eyesvision.ru eyesvisions.com factoringfee.ru filmzones.ru gadwall....GregoryFax — 01:24 AM
Teen girl - Nc 876
have a peek here bread wallet downloadMarcusElaky — 01:16 AM

chat

chat chat chat

  • Contact Us
  • Return to Top
  • Lite (Archive) Mode
Community Forum Software by MyBB
Designed By Rooo.
Top